How do I install the Blast skill?

Run npx skillmds@latest add lamm-mit/blast in your terminal (requires Node.js), paste this page's agent-chat prompt into Claude, Cursor, or any MCP-connected agent, or download the SKILL.md file and copy it into your agent's skills directory.

Is Blast safe to use?

This skill has not completed SkillMD's automated safety review yet. SkillMD never runs a skill's scripts for you; review the SKILL.md before installing.

Which AI agents work with Blast?

This skill is tagged as working with Claude Code, Claude.ai, OpenAI Codex. SKILL.md is an open format, so most agents that read a skills directory can load it too.

Is Blast free to use?

Yes. Installing skills from SkillMD is free, and the skill stays under its author's original license.

lamm-mit (@lamm-mit) published this skill. Their other Agent Skills are listed on their SkillMD profile.

Blast by lamm-mit — Agent Skill

Name: Blast
Author: lamm-mit

File contents

BLAST Search

Run NCBI BLAST (Basic Local Alignment Search Tool) searches to find sequence homology against NCBI databases.

Overview

BLAST finds regions of similarity between biological sequences. The program compares nucleotide or protein sequences to sequence databases and calculates the statistical significance of matches.

Usage

Basic protein BLAST search:

python3 {baseDir}/scripts/blast_search.py --query "MTEYKLVVVGAGGVGKSALTIQLIQ" --program blastp

Nucleotide search:

python3 {baseDir}/scripts/blast_search.py --query "ATGCGATCGATCGATCG" --program blastn

Search from FASTA file:

python3 {baseDir}/scripts/blast_search.py --query /path/to/sequence.fasta --database nr --program blastp

Get detailed output:

python3 {baseDir}/scripts/blast_search.py --query "SEQUENCE" --program blastp --format detailed --max-hits 20

Parameters

Parameter	Description	Default
`--query`	Amino acid/nucleotide sequence or path to FASTA file	Required
`--program`	BLAST program: blastn, blastp, blastx, tblastn, tblastx	blastp
`--database`	Database to search: nr, nt, refseq_protein, refseq_rna, swissprot, pdb	nr
`--evalue`	E-value threshold	10.0
`--max-hits`	Maximum number of hits to return	10
`--format`	Output format: summary, detailed, json	summary

BLAST Programs

blastp: Protein query vs protein database
blastn: Nucleotide query vs nucleotide database
blastx: Translated nucleotide query vs protein database
tblastn: Protein query vs translated nucleotide database
tblastx: Translated nucleotide query vs translated nucleotide database

Databases

nr: Non-redundant protein sequences
nt: Non-redundant nucleotide sequences
refseq_protein: NCBI Reference Sequence protein database
refseq_rna: NCBI Reference Sequence RNA database
swissprot: Swiss-Prot protein database (curated)
pdb: Protein Data Bank sequences

Examples

Find similar proteins to human p53:

python3 {baseDir}/scripts/blast_search.py --query "MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP" --program blastp --database swissprot

Search for homologs with strict E-value:

python3 {baseDir}/scripts/blast_search.py --query "MTEYKLVVVGAGGVGKSALTIQLIQ" --evalue 0.001 --max-hits 50

Output

The tool returns:

Hit accession and description
E-value and bit score
Percent identity and alignment length
Query and subject coverage
Alignment details (in detailed mode)

Notes

BLAST searches are submitted to NCBI servers and may take 30 seconds to several minutes
For large-scale searches, consider using local BLAST+ installation
NCBI requests that you provide an email for heavy usage (set NCBI_EMAIL environment variable)

---name: blastdescription: Search NCBI BLAST for sequence homology and find similar sequences in biological databases---# BLAST SearchRun NCBI BLAST (Basic Local Alignment Search Tool) searches to find sequence homology against NCBI databases.## OverviewBLAST finds regions of similarity between biological sequences. The program compares nucleotide or protein sequences to sequence databases and calculates the statistical significance of matches.## Usage### Basic protein BLAST search:```bashpython3 {baseDir}/scripts/blast_search.py --query "MTEYKLVVVGAGGVGKSALTIQLIQ" --program blastp```### Nucleotide search:```bashpython3 {baseDir}/scripts/blast_search.py --query "ATGCGATCGATCGATCG" --program blastn```### Search from FASTA file:```bashpython3 {baseDir}/scripts/blast_search.py --query /path/to/sequence.fasta --database nr --program blastp```### Get detailed output:```bashpython3 {baseDir}/scripts/blast_search.py --query "SEQUENCE" --program blastp --format detailed --max-hits 20```## Parameters| Parameter | Description | Default ||-----------|-------------|---------|| `--query` | Amino acid/nucleotide sequence or path to FASTA file | Required || `--program` | BLAST program: blastn, blastp, blastx, tblastn, tblastx | blastp || `--database` | Database to search: nr, nt, refseq_protein, refseq_rna, swissprot, pdb | nr || `--evalue` | E-value threshold | 10.0 || `--max-hits` | Maximum number of hits to return | 10 || `--format` | Output format: summary, detailed, json | summary |## BLAST Programs- **blastp**: Protein query vs protein database- **blastn**: Nucleotide query vs nucleotide database- **blastx**: Translated nucleotide query vs protein database- **tblastn**: Protein query vs translated nucleotide database- **tblastx**: Translated nucleotide query vs translated nucleotide database## Databases- **nr**: Non-redundant protein sequences- **nt**: Non-redundant nucleotide sequences- **refseq_protein**: NCBI Reference Sequence protein database- **refseq_rna**: NCBI Reference Sequence RNA database- **swissprot**: Swiss-Prot protein database (curated)- **pdb**: Protein Data Bank sequences## Examples### Find similar proteins to human p53:```bashpython3 {baseDir}/scripts/blast_search.py --query "MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGP" --program blastp --database swissprot```### Search for homologs with strict E-value:```bashpython3 {baseDir}/scripts/blast_search.py --query "MTEYKLVVVGAGGVGKSALTIQLIQ" --evalue 0.001 --max-hits 50```## OutputThe tool returns:- Hit accession and description- E-value and bit score- Percent identity and alignment length- Query and subject coverage- Alignment details (in detailed mode)## Notes- BLAST searches are submitted to NCBI servers and may take 30 seconds to several minutes- For large-scale searches, consider using local BLAST+ installation- NCBI requests that you provide an email for heavy usage (set NCBI_EMAIL environment variable)

Frequently asked questions

Blast