protein-language-models
When to Use
- Need per-residue or per-sequence embeddings from protein sequence for downstream ML (classification, clustering, similarity search)
- Need fast single-sequence structure prediction without building an MSA (ESMFold)
- Scoring the fitness effect of point mutations zero-shot — deep mutational scanning triage, variant-of-uncertain-significance (VUS) prioritization — with ESM-1v
- Designing or redesigning a protein sequence for a fixed backbone (inverse folding) with ESM-IF1
- Extracting attention-derived contact maps as a fast alternative to full structure prediction
Version Compatibility
- fair-esm ≥ 2.0.0 (
pip install fair-esm), PyTorch ≥ 2.0, Python ≥ 3.9 - CUDA GPU recommended for ESM2-650M+ and ESMFold; ESM2-8M/35M run fine on CPU
- biotite ≥ 0.39 required for ESM-IF1 structure loading
Prerequisites
pip install fair-esm torch biotite matplotlib- Familiarity with PyTorch tensors and basic protein sequence/FASTA concepts (see
bio-sequence-manipulation-seq-objects) - ESMFold and ESM-IF1 strongly prefer a CUDA GPU with ≥16GB VRAM
Quick Reference
| Model | Parameters | Best For |
|---|---|---|
| ESM2-8M | 8M | Fast embeddings, resource-constrained |
| ESM2-650M | 650M | Good quality, fits T4 GPU |
| ESM2-3B | 3B | High quality, requires A100 |
| ESM2-15B | 15B | State-of-the-art, multi-GPU |
| ESMFold | 690M | Fast structure prediction (no MSA) |
| ESM-1v | 650M×5 | Zero-shot mutation scoring |
| ESM-IF1 | 142M | Inverse folding / sequence design |
Goal: turn protein sequences into fixed-length vectors for downstream ML (clustering, similarity search, classifiers). Approach: run ESM2, extract per-residue representations from the final layer, mean-pool over the true (unpadded) residue span per sequence.
import esm
import torch
import numpy as np
def embed_sequences(seqs, model_name='esm2_t33_650M_UR50D', layer=33):
"""Compute per-sequence ESM2 embeddings via mean-pooling residue representations.
Args:
seqs: list of (name, sequence) tuples
model_name: attribute name on esm.pretrained (e.g. 'esm2_t33_650M_UR50D')
layer: transformer layer to pool from (33 = last layer of the 650M model)
Returns:
np.ndarray of shape (n_seqs, embed_dim)
"""
model, alphabet = getattr(esm.pretrained, model_name)()
model.eval()
batch_converter = alphabet.get_batch_converter()
_, _, batch_tokens = batch_converter(seqs)
with torch.no_grad():
results = model(batch_tokens, repr_layers=[layer], return_contacts=False)
token_rep = results['representations'][layer]
# Slice per true sequence length (not the batch max) to avoid padding tokens
# in the mean, and skip index 0 (<cls>/BOS token).
embeddings = [
token_rep[i, 1:len(seq) + 1].mean(0).numpy()
for i, (_, seq) in enumerate(seqs)
]
return np.vstack(embeddings)
data = [
('protein_A', 'MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGD'),
('protein_B', 'MKTLLLTLVVVTIVCLDLGYTPETRFLLKFNKAVIVAGTNTK'),
]
seq_embeddings = embed_sequences(data)
print(seq_embeddings.shape) # (2, 1280)
Goal: predict a 3D structure and per-residue confidence directly from sequence, no MSA needed.
Approach: load ESMFold once, call .infer() for the confidence dict and .infer_pdb() for a writable PDB string.
import esm
import torch
def predict_structure(sequence, out_pdb='esmfold_structure.pdb'):
"""Predict structure with ESMFold, write a PDB, and return mean pLDDT.
pLDDT interpretation: >90 very confident, 70-90 confident, 50-70 low,
<50 likely disordered/unreliable.
"""
model = esm.pretrained.esmfold_v1().eval().to('cuda')
with torch.no_grad():
pdb_str = model.infer_pdb(sequence)
output = model.infer(sequence)
with open(out_pdb, 'w') as f:
f.write(pdb_str)
plddt = output['plddt'].squeeze().cpu().numpy()
return float(plddt.mean())
mean_plddt = predict_structure('MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEK')
print(f'Mean pLDDT: {mean_plddt:.2f}')
Goal: rank candidate point mutations without any labeled fitness data. Approach: mask the mutated position, compare the model's log-probability of the wild-type vs. mutant residue at that position (masked marginal method).
import esm
import torch
model, alphabet = esm.pretrained.esm1v_t33_650M_UR90S_1()
model.eval()
batch_converter = alphabet.get_batch_converter()
def score_mutation(wt_seq, position, wt_aa, mut_aa):
"""Score a mutation's effect via masked marginal log-likelihood.
Args:
position: 0-indexed position in wt_seq
Returns:
log P(mut | context) - log P(wt | context); negative = destabilizing/deleterious
"""
_, _, batch_tokens = batch_converter([('protein', wt_seq)])
masked_tokens = batch_tokens.clone()
masked_tokens[0, position + 1] = alphabet.mask_idx # +1 for the <cls>/BOS token
with torch.no_grad():
logits = model(masked_tokens)['logits']
log_probs = torch.nn.functional.log_softmax(logits[0, position + 1], dim=-1)
wt_idx = alphabet.get_idx(wt_aa)
mut_idx = alphabet.get_idx(mut_aa)
return (log_probs[mut_idx] - log_probs[wt_idx]).item()
wt_sequence = 'MDLSALRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDITKRSLQESTRFSQLVEELLKIICAFQLDTGLEYANSYNFAKKENNSPEHLKDEVSIIQSMGYRNACKESMLCTHSSLNFFPVSLNLNPFQNNRNQLQNELREQLKLRQLEMDLNRFLSEYRSSMSLNHLENSSAAQLKLMQQKELNQIFQELNFQNQNQNQNQNQ'
delta_llr = score_mutation(wt_sequence, 1, 'D', 'E') # D2E mutation, position 2 (1-indexed)
print(f'Delta log-likelihood: {delta_llr:.3f}')
Goal: get a fast contact map without running a full structure predictor.
Approach: enable return_contacts=True in the same ESM2 forward pass used for embeddings.
import esm
import torch
import matplotlib.pyplot as plt
model, alphabet = esm.pretrained.esm2_t33_650M_UR50D()
model.eval()
batch_converter = alphabet.get_batch_converter()
_, _, tokens = batch_converter([('protein', 'MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGD')])
with torch.no_grad():
results = model(tokens, repr_layers=[33], return_contacts=True)
contacts = results['contacts'][0] # (L, L) contact probability map
plt.matshow(contacts.numpy(), cmap='RdYlBu_r')
plt.title('ESM2 Contact Prediction')
plt.colorbar()
Goal: generate new sequences that are predicted to fold onto a given backbone (fixed-backbone design). Approach: load coordinates from a PDB with ESM-IF1's utilities, then sample sequences at a chosen temperature.
import esm
import esm.inverse_folding
model, alphabet = esm.pretrained.esm_if1_gvp4_t16_142M_UR50()
model.eval()
structure = esm.inverse_folding.util.load_structure('protein.pdb', 'A')
coords, native_seq = esm.inverse_folding.util.extract_coords_from_structure(structure)
# temperature=1.0 -> diverse samples; temperature=0.1 -> conservative, close to native
sampled_seq = model.sample(coords, temperature=1.0, partial_seq=None)
Pitfalls
- Padding: ESM pads to the batch's max length; mean-pool using each sequence's true length (as above), not the padded batch width — otherwise short sequences get diluted by padding-token representations
- Token offset: ESM prepends
<cls>at position 0, so residuei(0-indexed) lives at token indexi+1 - ESMFold speed/accuracy: ~0.5s/sequence on GPU vs. minutes-hours for AlphaFold2 with an MSA; ESMFold accuracy is somewhat lower, especially for shallow-MSA/orphan proteins
- Zero-shot scoring: masked-marginal scoring captures single-mutation effects well but does not model epistasis between simultaneous mutations
- Sequence length: ESM2/ESM-1v max context is 1024 tokens; window or truncate longer proteins and average per-window scores
- Model download size: 650M+ checkpoints are multi-GB downloads on first
esm.pretrained.*()call; cache the~/.cache/torch/hub/checkpointsdirectory across runs
See Also
ai-science-esm2-embeddings— narrower embedding/ESMFold quickstart using the same libraryalphafold-structure-prediction— MSA-based structure prediction and pLDDT/PAE interpretationbio-core-protein-structure— parse/analyze the PDB output of ESMFold or ESM-IF1 (RMSD, DSSP, contacts)ai-science-alphafold-protein-design— triage RFdiffusion/ProteinMPNN design candidates alongside ESM-IF1 outputs