Tooluniverse Antibody Engineering

Antibody Engineering & Optimization

AI-guided antibody optimization pipeline from preclinical lead to clinical candidate. Covers sequence humanization, structure modeling, affinity optimization, developability assessment, immunogenicity prediction, and manufacturing feasibility.

KEY PRINCIPLES:

1. Report-first approach - Create optimization report before analysis
2. Evidence-graded humanization - Score based on germline alignment and framework retention
3. Developability-focused - Assess aggregation, stability, PTMs, immunogenicity
4. Structure-guided - Use AlphaFold/PDB structures for CDR analysis
5. Clinical precedent - Reference approved antibodies for validation
6. Quantitative scoring - Developability score (0-100) combining multiple factors
7. English-first queries - Always use English terms in tool calls, even if user writes in another language. Respond in user's language

When to Use

Apply when user asks:

• "Humanize this mouse antibody sequence"
• "Optimize antibody affinity for [target]"
• "Assess developability of this antibody"
• "Predict immunogenicity risk for [sequence]"
• "Engineer bispecific antibody against [targets]"
• "Reduce aggregation in antibody formulation"
• "Design pH-dependent binding antibody"
• "Analyze CDR sequences and suggest mutations"

Critical Workflow Requirements

1. Report-First Approach (MANDATORY)

1. Create the report file FIRST:

   • File name: antibody_optimization_report.md
   • Initialize with section headers
   • Add placeholder: [Analyzing...]

2. Progressively update as analysis completes

3. Output separate files:

   • optimized_sequences.fasta - All optimized variants
   • humanization_comparison.csv - Before/after comparison
   • developability_assessment.csv - Detailed scores

2. Documentation Standards (MANDATORY)

Every optimization MUST include:

### Optimized Variant: VH_Humanized_v1

**Original Sequence**: EVQLVESGGGLVQPGG... (mouse)
**Humanized Sequence**: EVQLVQSGAEVKKPGA... (human framework)
**Humanization Score**: 87% human framework
**CDR Preservation**: 100% (all CDR residues retained)

**Metrics**:
| Metric | Original | Optimized | Change |
|--------|----------|-----------|--------|
| Humanness | 62% | 87% | +25% |
| Aggregation risk | 0.58 | 0.32 | -45% |
| Predicted KD | 5.2 nM | 3.8 nM | +27% affinity |
| Immunogenicity | High | Low | -65% |

*Source: IMGT germline analysis, IEDB predictions*

Phase 0: Tool Verification

Required Tools

Workflow Overview

Phase 1: Input Analysis & Characterization
├── Sequence annotation (CDRs, framework)
├── Species identification
├── Target antigen identification
├── Clinical precedent search
└── OUTPUT: Input characterization
    ↓
Phase 2: Humanization Strategy
├── Germline gene alignment (IMGT)
├── Framework selection
├── CDR grafting design
├── Backmutation identification
└── OUTPUT: Humanization plan
    ↓
Phase 3: Structure Modeling & Analysis
├── AlphaFold prediction
├── CDR conformation analysis
├── Epitope mapping
├── Interface analysis
└── OUTPUT: Structural assessment
    ↓
Phase 4: Affinity Optimization
├── In silico mutation screening
├── CDR optimization strategies
├── Interface improvement
└── OUTPUT: Affinity variants
    ↓
Phase 5: Developability Assessment
├── Aggregation propensity
├── PTM site identification
├── Stability prediction
├── Expression prediction
└── OUTPUT: Developability score
    ↓
Phase 6: Immunogenicity Prediction
├── MHC-II epitope prediction (IEDB)
├── T-cell epitope risk
├── Aggregation-related immunogenicity
└── OUTPUT: Immunogenicity risk score
    ↓
Phase 7: Manufacturing Feasibility
├── Expression level prediction
├── Purification considerations
├── Formulation stability
└── OUTPUT: Manufacturing assessment
    ↓
Phase 8: Final Report & Recommendations
├── Ranked variant list
├── Experimental validation plan
├── Next steps
└── OUTPUT: Comprehensive report

Phase 1: Input Analysis & Characterization

1.1 Sequence Annotation

def annotate_antibody_sequence(sequence):
    """Annotate antibody sequence with CDRs and framework regions."""

    # Use IMGT numbering scheme (standard for antibodies)
    # CDR definitions (IMGT):
    # CDR-H1: 27-38, CDR-H2: 56-65, CDR-H3: 105-117
    # CDR-L1: 27-38, CDR-L2: 56-65, CDR-L3: 105-117

    annotation = {
        'sequence': sequence,
        'length': len(sequence),
        'regions': {
            'FR1': sequence[0:26],
            'CDR1': sequence[26:38],
            'FR2': sequence[38:55],
            'CDR2': sequence[55:65],
            'FR3': sequence[65:104],
            'CDR3': sequence[104:117],
            'FR4': sequence[117:]
        }
    }

    return annotation

1.2 Species & Germline Identification

def identify_germline(tu, vh_sequence, vl_sequence):
    """Identify germline genes for VH and VL chains using IMGT."""

    # Search for human germline genes
    vh_germlines = tu.tools.IMGT_search_genes(
        gene_type="IGHV",
        species="Homo sapiens"
    )

    vl_germlines = tu.tools.IMGT_search_genes(
        gene_type="IGKV",  # or IGLV for lambda
        species="Homo sapiens"
    )

    # Get sequences for top matches
    # Calculate identity % for each germline
    # Return closest matches

    return {
        'vh_germline': 'IGHV1-69*01',
        'vh_identity': 87.2,
        'vl_germline': 'IGKV1-39*01',
        'vl_identity': 89.5
    }

1.3 Clinical Precedent Search

def search_clinical_precedents(tu, target_antigen):
    """Find approved/clinical antibodies against same target."""

    # Search Thera-SAbDab for clinical antibodies
    therapeutics = tu.tools.TheraSAbDab_search_by_target(
        target=target_antigen
    )

    approved = [ab for ab in therapeutics if ab['phase'] == 'Approved']
    clinical = [ab for ab in therapeutics if 'Phase' in ab['phase']]

    return {
        'approved_count': len(approved),
        'clinical_count': len(clinical),
        'examples': approved[:3],
        'insights': extract_design_patterns(approved)
    }

1.4 Output for Report

## 1. Input Characterization

### 1.1 Sequence Information

| Property | Heavy Chain (VH) | Light Chain (VL) |
|----------|------------------|------------------|
| **Length** | 118 aa | 107 aa |
| **Species** | Mouse (Mus musculus) | Mouse (Mus musculus) |
| **Humanness** | 62% | 68% |
| **Closest human germline** | IGHV1-69*01 (87% identity) | IGKV1-39*01 (90% identity) |

### 1.2 CDR Annotation (IMGT Numbering)

**Heavy Chain**:
- FR1: 1-26, CDR-H1: 27-38, FR2: 39-55, CDR-H2: 56-65, FR3: 66-104, CDR-H3: 105-117, FR4: 118-128

**CDR Sequences**:
| CDR | Sequence | Length | Canonical Class |
|-----|----------|--------|-----------------|
| CDR-H1 | GYTFTSYYMH | 10 | H1-13-1 |
| CDR-H2 | GIIPIFGTANY | 11 | H2-10-1 |
| CDR-H3 | ARDDGSYSPFDYWG | 14 | - (unique) |
| CDR-L1 | RASQSISSYLN | 11 | L1-11-1 |
| CDR-L2 | AASSLQS | 7 | L2-8-1 |
| CDR-L3 | QQSYSTPLT | 9 | L3-9-cis7-1 |

### 1.3 Target Information

| Property | Value |
|----------|-------|
| **Target** | PD-L1 (Programmed death-ligand 1) |
| **UniProt** | Q9NZQ7 |
| **Function** | Immune checkpoint, inhibits T-cell activation |
| **Disease relevance** | Cancer immunotherapy target |

### 1.4 Clinical Precedents

**Approved antibodies targeting PD-L1**:
1. **Atezolizumab** (Tecentriq) - IgG1, approved 2016
2. **Durvalumab** (Imfinzi) - IgG1, approved 2017
3. **Avelumab** (Bavencio) - IgG1, approved 2017

**Key insights**: All approved anti-PD-L1 antibodies use human IgG1 scaffolds with effector function modifications.

*Source: TheraSAbDab, UniProt*

Phase 2: Humanization Strategy

2.1 Framework Selection

def select_human_framework(tu, mouse_sequence, cdr_sequences):
    """Select optimal human framework for CDR grafting."""

    # Search IMGT for human germline genes
    vh_genes = tu.tools.IMGT_search_genes(
        gene_type="IGHV",
        species="Homo sapiens"
    )

    # For each candidate framework:
    # 1. Calculate sequence identity to mouse FR
    # 2. Check CDR canonical class compatibility
    # 3. Assess structural compatibility
    # 4. Consider clinical precedents

    candidates = []
    for gene in vh_genes[:20]:  # Top 20 human germlines
        gene_seq = tu.tools.IMGT_get_sequence(
            accession=gene['accession'],
            format='fasta'
        )

        score = calculate_framework_score(
            mouse_fr=extract_framework(mouse_sequence),
            human_fr=extract_framework(gene_seq),
            cdr_compatibility=check_cdr_compatibility(cdr_sequences, gene_seq)
        )

        candidates.append({
            'germline': gene['name'],
            'identity': score['identity'],
            'cdr_compatibility': score['cdr_compatibility'],
            'clinical_use': count_clinical_uses(gene['name']),
            'overall_score': score['total']
        })

    # Sort by overall score
    return sorted(candidates, key=lambda x: x['overall_score'], reverse=True)

2.2 CDR Grafting Design

def design_cdr_grafting(mouse_sequence, human_framework, cdr_sequences):
    """Design CDR grafting with backmutation identification."""

    # Graft mouse CDRs onto human framework
    grafted_sequence = graft_cdrs(
        human_framework=human_framework,
        mouse_cdrs=cdr_sequences
    )

    # Identify Vernier zone residues (affect CDR conformation)
    vernier_residues = [2, 27, 28, 29, 30, 47, 48, 67, 69, 71, 78, 93, 94]

    # Identify potential backmutations
    backmutations = []
    for pos in vernier_residues:
        if mouse_sequence[pos] != human_framework[pos]:
            backmutations.append({
                'position': pos,
                'human_aa': human_framework[pos],
                'mouse_aa': mouse_sequence[pos],
                'reason': 'Vernier zone - may affect CDR conformation',
                'priority': 'High' if pos in [27, 29, 30, 48] else 'Medium'
            })

    return {
        'grafted_sequence': grafted_sequence,
        'backmutations': backmutations,
        'humanness_score': calculate_humanness(grafted_sequence)
    }

2.3 Humanization Scoring

def calculate_humanization_score(sequence, human_germline):
    """Calculate comprehensive humanization score."""

    # Framework humanness (% identity to human germline)
    fr_identity = calculate_framework_identity(sequence, human_germline)

    # T-cell epitope content (lower is better)
    tcell_epitope_count = predict_tcell_epitopes(sequence)

    # Unusual residues in human context
    unusual_residues = count_unusual_residues(sequence)

    # Aggregation hotspots
    aggregation_motifs = find_aggregation_motifs(sequence)

    score = {
        'framework_humanness': fr_identity,  # 0-100%
        'cdr_preservation': 100,  # Always 100% initially
        'tcell_epitopes': tcell_epitope_count,
        'unusual_residues': unusual_residues,
        'aggregation_risk': len(aggregation_motifs),
        'overall_score': calculate_weighted_score(
            fr_identity, tcell_epitope_count, unusual_residues, aggregation_motifs
        )
    }

    return score

2.4 Output for Report

## 2. Humanization Strategy

### 2.1 Framework Selection

**Selected Human Frameworks**:

| Chain | Germline | Identity | CDR Compatibility | Clinical Use | Score |
|-------|----------|----------|-------------------|--------------|-------|
| **VH** | IGHV1-69*01 | 87.2% | Excellent | 127 antibodies | 94/100 |
| **VL** | IGKV1-39*01 | 89.5% | Excellent | 89 antibodies | 92/100 |

**Rationale**:
- IGHV1-69*01: Most frequently used human germline in therapeutic antibodies
- High sequence identity minimizes risk of affinity loss
- Excellent CDR canonical class compatibility
- Proven clinical track record

### 2.2 CDR Grafting Design

**Grafting Strategy**: Direct CDR transfer with Vernier zone optimization

| Region | Source | Sequence | Rationale |
|--------|--------|----------|-----------|
| FR1 | IGHV1-69*01 | EVQLVQSGAEVKKPGA... | Human framework |
| CDR-H1 | Mouse | GYTFTSYYMH | Retain binding |
| FR2 | IGHV1-69*01 | VKWVRQAPGQGLE... | Human framework |
| CDR-H2 | Mouse | GIIPIFGTANY | Retain binding |
| FR3 | IGHV1-69*01 | RVTMTTDTSTSTYME... | Human framework |
| CDR-H3 | Mouse | ARDDGSYSPFDYWG | Retain binding |
| FR4 | IGHJ4*01 | WGQGTLVTVSS | Human framework |

### 2.3 Backmutation Analysis

**Identified Vernier Zone Residues** (may require backmutation):

| Position | Human | Mouse | Region | Impact | Priority |
|----------|-------|-------|--------|--------|----------|
| 27 | T | A | CDR-H1 boundary | CDR conformation | High |
| 48 | I | V | FR2 | VH-VL interface | High |
| 67 | A | S | FR3 | CDR-H2 support | Medium |
| 71 | R | K | FR3 | CDR-H2 support | Medium |
| 93 | A | T | FR3 | CDR-H3 base | Medium |

**Recommendation**: Test versions with/without backmutations at positions 27 and 48

### 2.4 Humanized Sequences

**Version 1: Full humanization** (no backmutations)

VH_Humanized_v1 | 87% human framework EVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYMHWVRQAPGQGLEWMGGIIPIFGTANY AQKFQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARARDDGSYSPFDYWGQGTLVTVSS

**Version 2: With key backmutations** (positions 27, 48)

VH_Humanized_v2 | 85% human framework + backmutations EVQLVQSGAEVKKPGASVKVSCKASGYAFTSYYMHWVRQAPGQGLEWMVGIIPIFGTANY AQKFQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARARDDGSYSPFDYWGQGTLVTVSS

**Humanization Metrics**:
| Metric | Original (Mouse) | v1 (Full) | v2 (Backmut) |
|--------|------------------|-----------|--------------|
| Framework humanness | 62% | 87% | 85% |
| CDR preservation | 100% | 100% | 100% |
| Vernier zone match | Mouse | Human | Mixed |
| Predicted affinity | Baseline | 60-80% | 80-100% |

*Source: IMGT germline database, CDR analysis*

Phase 3: Structure Modeling & Analysis

3.1 AlphaFold Structure Prediction

def predict_antibody_structure(tu, vh_sequence, vl_sequence):
    """Predict antibody Fv structure using AlphaFold."""

    # Combine VH and VL with linker
    fv_sequence = vh_sequence + ":" + vl_sequence  # AlphaFold uses : for chain separator

    # Predict structure
    prediction = tu.tools.AlphaFold_get_prediction(
        sequence=fv_sequence,
        return_format='pdb'
    )

    # Extract pLDDT scores
    plddt_scores = extract_plddt(prediction)

    # Analyze by region
    regions = {
        'VH_FR': np.mean([plddt_scores[i] for i in range(0, 26)]),
        'CDR_H1': np.mean([plddt_scores[i] for i in range(26, 38)]),
        'CDR_H2': np.mean([plddt_scores[i] for i in range(55, 65)]),
        'CDR_H3': np.mean([plddt_scores[i] for i in range(104, 117)]),
        'VL_FR': np.mean([plddt_scores[i] for i in range(len(vh_sequence), len(vh_sequence)+26)]),
        'CDR_L1': np.mean([plddt_scores[i] for i in range(len(vh_sequence)+26, len(vh_sequence)+38)]),
    }

    return {
        'structure': prediction,
        'mean_plddt': np.mean(plddt_scores),
        'regional_plddt': regions,
        'cdr_confidence': np.mean([regions['CDR_H1'], regions['CDR_H2'], regions['CDR_H3']])
    }

3.2 CDR Conformation Analysis

def analyze_cdr_conformation(structure):
    """Analyze CDR loop conformations and canonical classes."""

    # Extract CDR coordinates
    cdr_coords = extract_cdr_regions(structure)

    # Classify canonical structures
    cdr_classes = {
        'CDR-H1': classify_canonical_structure(cdr_coords['H1']),
        'CDR-H2': classify_canonical_structure(cdr_coords['H2']),
        'CDR-H3': 'Non-canonical (14 aa)',  # Usually unique
        'CDR-L1': classify_canonical_structure(cdr_coords['L1']),
        'CDR-L2': classify_canonical_structure(cdr_coords['L2']),
        'CDR-L3': classify_canonical_structure(cdr_coords['L3'])
    }

    # Calculate RMSD to known canonical structures
    rmsd_values = calculate_canonical_rmsd(cdr_coords, cdr_classes)

    return {
        'classes': cdr_classes,
        'rmsd': rmsd_values,
        'confidence': assess_conformation_confidence(rmsd_values)
    }

3.3 Epitope Mapping

def map_epitope(tu, target_protein, antibody_structure):
    """Identify epitope on target protein."""

    # Get target structure or predict
    target_info = tu.tools.UniProt_get_protein_by_accession(
        accession=target_protein
    )

    # Search for known epitopes
    epitopes = tu.tools.iedb_search_epitopes(
        sequence_contains=target_protein,
        structure_type="Linear peptide",
        limit=20
    )

    # Search for structural antibody complexes
    sabdab_results = tu.tools.SAbDab_search_structures(
        query=target_info['protein_name']
    )

    # Analyze binding interface
    interface = {
        'epitope_candidates': epitopes,
        'structural_precedents': sabdab_results,
        'predicted_interface': predict_binding_interface(antibody_structure)
    }

    return interface

3.4 Output for Report

## 3. Structure Modeling & Analysis

### 3.1 AlphaFold Predictions

**Structure Quality**:

| Variant | Mean pLDDT | VH pLDDT | VL pLDDT | CDR pLDDT | Confidence |
|---------|------------|----------|----------|-----------|------------|
| Original (Mouse) | 89.2 | 91.4 | 88.7 | 85.3 | High |
| VH_Humanized_v1 | 87.8 | 89.6 | 88.2 | 83.1 | High |
| VH_Humanized_v2 | 88.9 | 90.8 | 88.5 | 84.8 | High |

**Regional Confidence (v2)**:
- Framework regions: 92.3 (very high)
- CDR-H1, H2, L1, L2: 87-91 (high)
- CDR-H3: 78.4 (moderate - expected for unique CDR-H3)
- VH-VL interface: 90.1 (high)

### 3.2 CDR Conformation Analysis

**Canonical Classes** (Humanized v2):

| CDR | Length | Canonical Class | RMSD to Class | Status |
|-----|--------|-----------------|---------------|--------|
| CDR-H1 | 10 | H1-13-1 | 0.8 Å | ✓ Maintained |
| CDR-H2 | 11 | H2-10-1 | 1.1 Å | ✓ Maintained |
| CDR-H3 | 14 | Non-canonical | N/A | Unique structure |
| CDR-L1 | 11 | L1-11-1 | 0.9 Å | ✓ Maintained |
| CDR-L2 | 7 | L2-8-1 | 0.7 Å | ✓ Maintained |
| CDR-L3 | 9 | L3-9-cis7-1 | 1.0 Å | ✓ Maintained |

**Assessment**: All CDR conformations well-preserved in humanized variants. Low RMSD values indicate minimal structural perturbation from humanization.

### 3.3 Epitope Analysis

**Known PD-L1 Epitopes** (IEDB):

| Epitope | Sequence | Position | Binding Antibodies | Conservation |
|---------|----------|----------|-------------------|--------------|
| Epitope 1 | LQDAG...VPEPP | 19-113 | Durvalumab, Avelumab | 98% |
| Epitope 2 | FTVT...PGPN | 54-68 | Atezolizumab | 100% |
| Epitope 3 | RLEDL...NVSI | 115-127 | Research Abs | 95% |

**Predicted Binding Interface**:
- Primary contact residues: CDR-H3 (70%), CDR-H1 (15%), CDR-H2 (10%)
- Secondary contacts: CDR-L3 (5%)
- Estimated buried surface area: 820 Ų

### 3.4 Structural Comparison

**Superposition with Clinical Antibodies** (SAbDab):

| Reference | PDB ID | VH RMSD | VL RMSD | CDR-H3 RMSD | Notes |
|-----------|--------|---------|---------|-------------|-------|
| Atezolizumab | 5X8L | 1.2 Å | 1.4 Å | 2.8 Å | Similar approach angle |
| Durvalumab | 5X8M | 1.8 Å | 1.5 Å | 3.4 Å | Different epitope |
| Research Ab | 5C3T | 0.9 Å | 1.1 Å | 1.5 Å | Very similar |

*Source: AlphaFold, IEDB, SAbDab*

Phase 4: Affinity Optimization

4.1 In Silico Mutation Screening

def design_affinity_variants(antibody_structure, target_structure):
    """Design affinity maturation variants using computational screening."""

    # Identify interface residues
    interface_residues = identify_interface_residues(
        antibody_structure,
        target_structure,
        distance_cutoff=4.5  # Angstroms
    )

    # Focus on CDR residues
    cdr_interface = [res for res in interface_residues if is_cdr_residue(res)]

    # Design mutations for each position
    variants = []
    for position in cdr_interface:
        # Try all amino acids except original
        for aa in 'ACDEFGHIKLMNPQRSTVWY':
            if aa != antibody_structure.sequence[position]:
                predicted_ddg = predict_binding_energy_change(
                    structure=antibody_structure,
                    mutation=f"{antibody_structure.sequence[position]}{position}{aa}"
                )

                if predicted_ddg < -0.5:  # Favorable change (more negative = better)
                    variants.append({
                        'position': position,
                        'original': antibody_structure.sequence[position],
                        'mutant': aa,
                        'predicted_ddg': predicted_ddg,
                        'predicted_kd_fold': calculate_kd_change(predicted_ddg)
                    })

    # Rank by predicted improvement
    return sorted(variants, key=lambda x: x['predicted_ddg'])

4.2 CDR Optimization Strategies

def cdr_optimization_strategies(cdr_sequence, cdr_name):
    """Identify CDR optimization strategies based on sequence and structure."""

    strategies = []

    # Strategy 1: Extend CDR for increased contact area
    if len(cdr_sequence) < 12 and cdr_name == 'CDR-H3':
        strategies.append({
            'strategy': 'CDR-H3 extension',
            'rationale': 'Add 1-2 residues to increase contact surface',
            'expected_impact': '+2-5x affinity improvement',
            'examples': ['Extension with Gly-Tyr', 'Extension with Ser-Asp']
        })

    # Strategy 2: Tyrosine enrichment
    tyr_count = cdr_sequence.count('Y')
    if tyr_count < 2:
        strategies.append({
            'strategy': 'Tyrosine enrichment',
            'rationale': 'Tyr provides pi-stacking and H-bonds',
            'expected_impact': '+2-3x affinity improvement',
            'targets': suggest_tyr_positions(cdr_sequence)
        })

    # Strategy 3: Charged residue optimization
    if 'PD' in cdr_sequence or 'EP' in cdr_sequence:
        strategies.append({
            'strategy': 'Salt bridge formation',
            'rationale': 'Add charged residues for electrostatic interactions',
            'expected_impact': '+1-2x affinity and pH sensitivity',
            'targets': identify_salt_bridge_opportunities(cdr_sequence)
        })

    return strategies

4.3 Output for Report

## 4. Affinity Optimization

### 4.1 Current Affinity Assessment

| Property | Value | Method |
|----------|-------|--------|
| **Predicted KD** | 5.2 nM | Structure-based prediction |
| **Buried surface area** | 820 Ų | AlphaFold model |
| **Interface hotspots** | 6 residues | Energy decomposition |

**Target**: Single-digit nM affinity (KD < 5 nM)

### 4.2 Proposed Affinity Mutations

**High-Priority Mutations** (predicted >2x improvement):

| Position | Original | Mutant | Region | Predicted ΔΔG | KD Fold Improvement | Rationale |
|----------|----------|--------|--------|---------------|---------------------|-----------|
| H100a | S | Y | CDR-H3 | -1.2 kcal/mol | 7.4x | Pi-stacking with target Phe |
| H52 | I | W | CDR-H2 | -0.9 kcal/mol | 4.8x | Increased hydrophobic contact |
| L91 | Q | E | CDR-L3 | -0.7 kcal/mol | 3.3x | Salt bridge with target Arg |
| H58 | G | S | CDR-H2 | -0.6 kcal/mol | 2.7x | H-bond to target backbone |

**Medium-Priority Mutations** (predicted 1.5-2x improvement):

| Position | Original | Mutant | Region | Predicted ΔΔG | KD Fold Improvement | Rationale |
|----------|----------|--------|--------|---------------|---------------------|-----------|
| H33 | Y | F | CDR-H1 | -0.5 kcal/mol | 2.3x | Optimize stacking geometry |
| L50 | A | T | CDR-L2 | -0.4 kcal/mol | 2.0x | Additional H-bond |

### 4.3 Combination Strategy

**Recommended Testing Order**:

1. **Single mutants**: H100aY, H52W, L91E (test individually)
2. **Double mutants**: H100aY+H52W, H100aY+L91E (best combinations)
3. **Triple mutant**: H100aY+H52W+L91E (if additivity observed)

**Expected Outcome**:
- Single mutants: KD 1.5-2.5 nM (3-7x improvement)
- Best double mutant: KD 0.7-1.2 nM (7-15x improvement)
- Triple mutant: KD 0.3-0.6 nM (15-30x improvement) if additive

### 4.4 CDR Optimization Strategies

**Strategy 1: CDR-H3 Extension**
- Current length: 14 aa
- Proposed: Add Gly-Tyr at C-terminus (16 aa total)
- Rationale: Fill gap in binding interface, Tyr provides pi-stacking
- Expected impact: +2-3x affinity

**Strategy 2: Tyrosine Enrichment**
- Current Tyr count: 3 in CDRs
- Target positions: H33, H52a, L96
- Rationale: Tyr provides both hydrophobic and H-bond contacts
- Expected impact: +2-4x affinity

**Strategy 3: pH-Dependent Binding (Optional)**
- For tumor-selective uptake
- Add His residues at interface: H100a, L91
- pKa ~6.0: Bind at pH 7.4, release at pH 6.0
- Expected impact: Tumor selectivity, faster recycling

*Source: In silico modeling, structural analysis*

Extended Reference: For detailed tool tables, examples, and templates, read REFERENCE.md in this skill directory. The agent can access it via: read skills/tooluniverse-antibody-engineering/REFERENCE.md